PGRMC1 (Progesterone Receptor Membrane Component 1, HPR6.6, MPR)

Size

£685.00

SKU:: 250038
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: PGRMC1 (NP_006658.1, 96aa-195aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.