P11 (26 Serine Protease, MGC133268, PP11, PRSS26)

Size

£685.00

SKU:: 249691
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: P11 (NP_006016.1, 270aa-369aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a protein with protease activity. Its specific function has not been determined. The protein may be useful as a tumor marker. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.