249594
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19)
Size
£685.00
- SKU:
- 249594
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- OLIG2 (AAH36245.1, 1aa-323aa) full-length human protein.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKLGGSGFKSSSSSTSSSTSSMouse polyclonal antibody raised against a full-length human OLIG2 protein.SSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPMouse polyclonal antibody raised against a full-length human OLIG2 protein.AHAAHHPAVHHPILPPMouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.AVSSASLPGSGLPSVGSIRPPHGLLKSPSMouse polyclonal antibody raised against a full-length human OLIG2 protein.AAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice