NRK (Nik Related Kinase, DKFZp686A17109, FLJ16788, MGC131849, NESK)

Size

£685.00

SKU:: 249497
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NRK (NP_940867, 1483aa-1582aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: NRK is a member of the GCK (MIM 138079) subfamily of protein kinases that are involved in activating the JNK pathway (Kanai-Azuma et al., 1999 [PubMed 10559491]).[supplied by OMIM Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.