NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf)

Size

£685.00

SKU:: 249356
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NME2 (NP_002503, 51aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.