249314-PE

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (PE)

Size

£914.00

SKU:: 249314-PE
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NHLH2 (NP_005590, 36aa-135aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3.0e+11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant NHLH2. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.