NEUROD6 (Neurogenic Differentiation 6, Atoh2, MATH2, Math-2, NEX1M, bHLHa2)

Size

£698.00

SKU:: 249247
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NEUROD6 (NP_073565.2, 191aa-290aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G11
Format:: Supplied as a liquid.
Extra Details:: NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.