NDUFB11 (NADH Dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kD, ESSS, FLJ20494, MGC111182, NP17.3, Np15, P17.3)

Size

£685.00

SKU:: 249201
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NDUFB11 (AAH10665, 1aa-153aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAGLFGLSARRLLMouse monoclonal antibody raised against a full length recombinant NDUFB11.ATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.