NDNL2 (Necdin-like 2, HCA4, MAGEG1, MAGEL3, NSE3, NSMCE3)

Size

£685.00

SKU:: 249182
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: NDNL2 (NP_619649.1, 2aa-52aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This intronless gene encodes a member of the MAGE superfamily. The encoded protein is 76% identical to the mouse mage-g1 protein. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.