248959-PE

MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184) (PE)

Size

£914.00

SKU:: 248959-PE
Application:: FLISA
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MSL2 (NP_060603, 478aa-575aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MSL2. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.