MORF4 (Mortality Factor 4, CSR, CSRB, SEN, SEN1)

Size

£685.00

SKU:: 248838
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MORF4 (NP_006783.2, 1aa-235aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: Cellular senescence, the terminal nondividing state that normal cells enter following completion of their proliferative potential, is the dominant phenotype in hybrids of normal and immortal cells. Fusions of immortal human cell lines with each other have led to their assignment to 1 of several complementation groups. MORF4 is a gene on chromosome 4 that induces a senescent-like phenotype in cell lines assigned to complementation group B.[supplied by OMIM Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRWAAPGKKTSGLQQKNIEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRAQVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAEKNVDSILEDYANYKKSHGNTDNKEYAVNEVVAGIKEYFNLMLGTQLLNKFERPQYAEILADCPDAPMSQVYGVPHLLRLSVQIGAMLAYTPLNEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHRKAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.