MLN (Motilin, MGC138519)

Size

£685.00

SKU:: 248801
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MLN (AAH69675.1, 1aa-115aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4.0e+12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Two transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVSRKAVAALLVVHMouse monoclonal antibody raised against a full-length recombinant MLN.MLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.