248797-APC

MLLT10 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated to, 10, AF10, DKFZp686E10210, MGC75086) (APC)

Size

£914.00

SKU:: 248797-APC
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MLLT10 (NP_001009569, 695aa-793aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6H7
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MLLT10. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.