MED13L (Mediator Complex Subunit 13-like, DKFZp781D0112, FLJ21627, KIAA1025, PROSIT240, THRAP2, TRAP240L)

Size

£685.00

SKU:: 248625
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MED13L (NP_056150, 1186aa-1285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The evolutionarily conserved THRAP genes encode a family of proteins that regulate embryonic development. THRAP2 is involved in early development of the heart and brain (Muncke et al., 2003 [PubMed 14638541]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.