MAST4 (Microtubule Associated Serine/Threonine Kinase Family Member 4, DKFZp686E18148, DKFZp686N1467, FLJ16540, FLJ33039, KIAA0303)

Size

£685.00

SKU:: 248554
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MAST4 (XP_291141, 2605aa-2699aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAST4. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPLESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGRDVTKPSPAPNTDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.