248554-PE

MAST4 (Microtubule Associated Serine/Threonine Kinase Family Member 4, DKFZp686E18148, DKFZp686N1467, FLJ16540, FLJ33039, KIAA0303) (PE)

Size

£914.00

SKU:: 248554-PE
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MAST4 (XP_291141, 2605aa-2699aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAST4. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPLESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGRDVTKPSPAPNTDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.