MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL)

Size

£685.00

SKU:: 248542
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MARCKS (NP_002347, 2aa-65aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAQFSKTAAKGEMouse monoclonal antibody raised against a partial recombinant MARCKS.ERPGEAAVASSPSKANGQENGHVKVNGDASPMouse monoclonal antibody raised against a partial recombinant MARCKS.ESGAKEELQANGSAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.