MAF (V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (avian), MGC71685, c-MAF)

Size

£698.00

SKU:: 248378
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: MAF (NP_005351, 304aa-403aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B6
Format:: Supplied as a liquid.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAF. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.