248311-APC

LRG1 (Leucine-Rich alpha-2-Glycoprotein 1, HMFT1766, LRG) (APC)

Size

£914.00

SKU:: 248311-APC
Application:: FLISA
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: LRG1 (AAH34389, 37aa-347aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H1
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).[supplied by OMIM Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice