LCN12 (lipocalin 12, MGC34753, MGC48935)

Size

£685.00

SKU:: 248090
Application:: WB
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: LCN12 (AAH41168, 1aa-355aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPAGMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLSWATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLGYLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPWVAAPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.