247821
KCNK1 (Potassium Channel, Subfamily K, Member 1, DPK, HOHO, K2p1.1, KCNO1, TWIK-1, TWIK1)
Size
£685.00
- SKU:
- 247821
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- KCNK1 (NP_002236.1, 265aa-336aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4D7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice