IRX1 (Iroquois Homeobox 1, IRX-5, IRXA1)

Size

£685.00

SKU:: 247722
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: IRX1 (NP_077313, 424aa-479aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: IRX1 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.