247076
HIC1 (Hypermethylated in Cancer 1, ZBTB29, hic-1)
Size
£698.00
- SKU:
- 247076
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- HIC1 (NP_006488.2, 627aa-705aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C1
- Format:
- Supplied as a liquid.
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant HIC1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEGVFAVARLTAEQLSLKQQDKMouse monoclonal antibody raised against a partial recombinant HIC1.AELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice