HES5 (Hairy and Enhancer of Split 5 (Drosophila), bHLHb38)

Size

£685.00

SKU:: 247024
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: HES5 (NP_001010926, 28aa-121aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVMouse monoclonal antibody raised against a full length recombinant HES5.GPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.