FUT4 (Fucosyltransferase 4 (alpha (1,3) Fucosyltransferase, Myeloid-Specific), CD15, ELFT, FCT3A, FUC-TIV, FUTIV)

Size

£685.00

SKU:: 246404
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: FUT4 (NP_002024.1, 167aa-265aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8B2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.