FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ)

Size

£685.00

SKU:: 246358
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: FRZB (NP_001454, 102aa-190aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant FRZB. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.