FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7)

Size

£685.00

SKU:: 246295
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: FOXL1 (NP_005241, 132aa-240aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant FOXL1. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGMouse monoclonal antibody raised against a full length recombinant FOXL1.VAVGQAARTGDGP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.