246272
FOXD1 (Forkhead Box D1, FKHL8, FREAC4)
Size
£685.00
- SKU:
- 246272
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- FOXD1 (AAI60026.1, 1aa-465aa) full-length human protein.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This intronless gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in tumor formation. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNMouse polyclonal antibody raised against a full-length human FOXD1 protein.AESLLLRGAGAAGGAGDPMouse polyclonal antibody raised against a full-length human FOXD1 protein.AALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAFHPHSPPPPPPPHGMouse polyclonal antibody raised against a full-length human FOXD1 protein.ELARTAFGYRPHPLGAALPGPLPASAAKAGGPGASALARSPFSIESIIGGSLGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQMouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.LTRSLVMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.ASSVSSSAALGTLHQGTALSSVENFTARISNC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice