FKBP10 (FK506 Binding Protein 10, 65kD, FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65)

Size

£685.00

SKU:: 246138
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: FKBP10 (NP_068758, 377aa-470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.