ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, CD39L3, FLJ93839, HB6, NTPDase-3)

Size

£685.00

SKU:: 245744
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ENTPD3 (NP_001239, 107aa-216aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 300000000
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.