EBF4 (Early B-Cell Factor 4, COE4, KIAA1442, O/E-4)

Size

£685.00

SKU:: 245574
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: EBF4 (AAH54347.1, 1aa-88aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4.0e+10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSSPPLMouse monoclonal antibody raised against a full-length recombinant EBF4.SSMSLPMouse monoclonal antibody raised against a full-length recombinant EBF4.PTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.