245286-BIOTIN
DEGS1 (Degenerative Spermatocyte Homolog 1, lipid Desaturase (Drosophila), DEGS, DES1, Des-1, FADS7, MGC5079, MIG15, MLD) (Biotin)
Size
£914.00
- SKU:
- 245286-BIOTIN
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- DEGS1 (NP_003667, 226aa-323aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2.0e+9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice