DEAF1 (Deformed Epidermal Autoregulatory Factor 1 (Drosophila), NUDR, SPN, ZMYND5)

Size

£685.00

SKU:: 245277
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: DEAF1 (NP_066288, 466aa-564aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6F10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DEAF1. Applications: Suitable for use in ELISA, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVT Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.