DDEF1 (ArfGAP with SH3 Domain, Ankyrin Repeat and PH Domain 1, AMAP1, CENTB4, DDEF1, KIAA1249, PAG2, PAP, ZG14P)

Size

£685.00

SKU:: 245239
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: DDEF1 (NP_060952, 1030aa-1129aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DDEF1. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.