DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369)

Size

£685.00

SKU:: 245203
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: DCAMKL1 (NP_004725, 640aa-729aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.