DAB2IP (DAB2 Interacting Protein, AF9Q34, AIP1, DIP1/2, FLJ39072, KIAA1743)

Size

£685.00

SKU:: 245181
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: DAB2IP (NP_115941.1, 551aa-650aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8C10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: DAB2IP is a Ras (MIM 190020) GTPase-activating protein (GAP) that acts as a tumor suppressor gene and is inactivated by methylation in prostate and breast cancers (Yano et al., 2005 [PubMed 15386433]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQMouse monoclonal antibody raised against a partial recombinant DAB2IP.AQLVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.