CYB5-M (Cytochrome b5 Type B (outer Mitochondrial Membrane), CYB5-M, CYPB5M, DKFZp686M0619, OMB5)

Size

£685.00

SKU:: 245127
Application:: WB
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CYB5-M (AAH04373, 1aa-146aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: Mouse polyclonal antibody raised against a full-length human CYB5-M protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.