CX3CR1 (Chemokine (C-X3-C Motif) Receptor 1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28)

Size

£685.00

SKU:: 245094
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-36 of human CX3CR1 (AAH28078) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 10D5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CX3CR1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.