CTA-250D10.11 (WBP2 N-terminal like, FLJ26145, MGC26816, PAWP)

Size

£685.00

SKU:: 245037
Application:: WB
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CTA-250D10.11 (AAH22546, 1aa-309aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASMouse polyclonal antibody raised against a full-length human CTA-250D10.11 protein.RGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.