CHD9 (Chromodomain Helicase DNA Binding Protein 9, AD013, CReMM, KISH2, PRIC320)

Size

£685.00

SKU:: 244658
Application:: IF
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CHD9 (AAH33770.1, 1aa-119aa) full-length human protein.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Mouse polyclonal antibody raised against a full-length human CHD9 protein. Applications: Suitable for use in Immunofluorescence. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.