244623-ML490
CETN1 (centrin, EF-hand Protein, 1, CEN1, CETN) (MaxLight 490)
Size
£914.00
- SKU:
- 244623-ML490
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CETN1 (AAH29515.1, 16aa-94aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4C12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice