CDX2 (Caudal Type Homeobox 2, CDX-3, CDX3)

Size

£698.00

SKU:: 244566
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CDX2 (AAH14461.1, 1aa-313aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C7
Format:: Supplied as a liquid.
Extra Details:: The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al., 1994 [PubMed 7698771]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVMouse monoclonal antibody raised against a full-length recombinant CDX2.Mouse monoclonal antibody raised against a full-length recombinant CDX2.AANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGMouse monoclonal antibody raised against a full-length recombinant CDX2.AANAVAHGPNGGSPMouse monoclonal antibody raised against a full-length recombinant CDX2.MGYSSPADYHPHHHPHHHPHHPMouse monoclonal antibody raised against a full-length recombinant CDX2.PSCASGLLQTLNPGPPGPAATMouse monoclonal antibody raised against a full-length recombinant CDX2.EQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice