244318-BIOTIN

CCL3 (Chemokine (C-C Motif) Ligand 3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3) (Biotin)

Size

£914.00

SKU:: 244318-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: CCL3 (NP_002974, 24aa-92aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2.0e+9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988 [PubMed 3279154]). Sherry et al. (1988) [PubMed 3058856] demonstrated 2 protein components of MIP1, called by them alpha and beta.[supplied by OMIM Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.