244304-ML650
CCL15 (Chemokine (C-C Motif) Ligand 15, HCC-2, HMRP-2B, LKN1, Lkn-1, MIP-1d, MIP-5, NCC-3, NCC3, SCYA15, SCYL3, SY15) (MaxLight 650)
Size
£914.00
- SKU:
- 244304-ML650
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CCL15 (NP_116741, 25aa-113aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice