244237
CARTPT (CART prepropeptide, CART)
Size
£685.00
- SKU:
- 244237
- Application:
- WB
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CARTPT (AAH29882.1, 1aa-116aa) full-length human protein.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- CART appears to have roles in reward, feeding, and stress, and it has the functional properties of an endogenous psychostimulant (Kuhar et al., 2002 [PubMed 12147208]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice