CAPN5 (Calpain 5, FLJ46245, HTRA3, nCL-3)

Size

£698.00

SKU:: 244219
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa523-622 from human CAPN5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C10
Format:: Supplied as a liquid.
Extra Details:: Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called as HTRA3. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNLQALHTLHLRDRNSRQPSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.