BST2 (Bone Marrow Stromal Cell antigen 2, CD317)

Size

£685.00

SKU:: 243899
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: BST2 (AAH33873.1, 1aa-180aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2000000
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSMouse monoclonal antibody raised against a full-length recombinant BST2.PQLLIVLLGLSALLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.