BRD3 (Bromodomain Containing 3, FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L)

Size

£685.00

SKU:: 243883
Purity:: Purified.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa418-556 of human BRD3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7G6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in ELISA Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. mmunohistochemsitry: Paraffin Sections Optimal dilutions to be determined by the researcher Amino Acid Sequence: EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAAGRDHFLTCGV Storage and Stability: For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.