ATP2A1 (ATPase, Ca++ Transporting, cardiac Muscle, fast twitch 1, ATP2A, SERCA1)

Size

£698.00

SKU:: 243627
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ATP2A1 (NP_775293, 522aa-612aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C9
Format:: Supplied as a liquid.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ATP2A1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.