ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46)

Size

£685.00

SKU:: 243542
Purity:: Purified.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa137-236 from human ASCL1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.